Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM182 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_80092 |
---|
Ki | 0.027000±n/a nM |
---|
Citation | Patel, M; Bacheler, LT; Rayner, MM; Cordova, BC; Klabe, RM; Erickson-Viitanen, S; Seitz, SP The synthesis and evaluation of cyclic ureas as HIV protease inhibitors: modifications of the P1/P1' residues. Bioorg Med Chem Lett8:823-8 (1999) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM182 |
---|
n/a |
---|
Name | BDBM182 |
Synonyms: | (4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis({[3-(1H-pyrazol-3-yl)phenyl]methyl})-1,3-diazepan-2-one | (4R,5S,6S,7R)-Hexahydro-5,6-dihydroxy-1,3-bis[[3-(1H-pyrazol-3-yl)phenyl]methyl]-4,7-bis(phenylmethyl)-2H-1,3-diazepin-2-one | CHEMBL38314 | Cyclic Urea |
Type | n/a |
Emp. Form. | C39H38N6O3 |
Mol. Mass. | 638.7574 |
SMILES | O[C@@H]1[C@@H](O)[C@@H](Cc2ccccc2)N(Cc2cccc(c2)-c2cc[nH]n2)C(=O)N(Cc2cccc(c2)-c2cc[nH]n2)[C@@H]1Cc1ccccc1 |
Structure |
|