Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Proteasome subunit beta type-5 |
---|
Ligand | BDBM50516221 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1863867 (CHEMBL4364842) |
---|
IC50 | 2200±n/a nM |
---|
Citation | Zhan, W; Visone, J; Ouellette, T; Harris, JC; Wang, R; Zhang, H; Singh, PK; Ginn, J; Sukenick, G; Wong, TT; Okoro, JI; Scales, RM; Tumwebaze, PK; Rosenthal, PJ; Kafsack, BFC; Cooper, RA; Meinke, PT; Kirkman, LA; Lin, G Improvement of Asparagine Ethylenediamines as Anti-malarial J Med Chem62:6137-6145 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-5 |
---|
Name: | Proteasome subunit beta type-5 |
Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
Type: | Protein |
Mol. Mass.: | 28480.96 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 263 |
Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
BDBM50516221 |
---|
n/a |
---|
Name | BDBM50516221 |
Synonyms: | CHEMBL4521059 |
Type | Small organic molecule |
Emp. Form. | C24H31FN4O5S |
Mol. Mass. | 506.59 |
SMILES | Cc1ccc(cc1)S(=O)(=O)N[C@@H](CC(=O)NC(C)(C)C)C(=O)NCCNC(=O)c1cccc(F)c1 |r| |
Structure |
|