| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Similar to alpha-tubulin isoform 1 |
|---|
| Ligand | BDBM50517543 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1869222 (CHEMBL4370288) |
|---|
| IC50 | 2500±n/a nM |
|---|
| Citation |  Romagnoli, R; Prencipe, F; Oliva, P; Baraldi, S; Baraldi, PG; Schiaffino Ortega, S; Chayah, M; Kimatrai Salvador, M; Lopez-Cara, LC; Brancale, A; Ferla, S; Hamel, E; Ronca, R; Bortolozzi, R; Mariotto, E; Mattiuzzo, E; Viola, G Design, Synthesis, and Biological Evaluation of 6-Substituted Thieno[3,2- d]pyrimidine Analogues as Dual Epidermal Growth Factor Receptor Kinase and Microtubule Inhibitors. J Med Chem62:1274-1290 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Similar to alpha-tubulin isoform 1 |
|---|
| Name: | Similar to alpha-tubulin isoform 1 |
|---|
| Synonyms: | Similar to alpha-tubulin isoform 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 10383.05 |
|---|
| Organism: | Bos taurus |
|---|
| Description: | ChEMBL_104716 |
|---|
| Residue: | 99 |
|---|
| Sequence: | CVSASPSTLARLVSRSAMPAGSSTAWNTAFSPMARCQVTKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRSSSTLSSSSQAKKMP
|
|
|
|---|
| BDBM50517543 |
|---|
| n/a |
|---|
| Name | BDBM50517543 |
|---|
| Synonyms: | CHEMBL4572443 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H18BrN3O3S |
|---|
| Mol. Mass. | 472.355 |
|---|
| SMILES | COc1cc(Nc2ncnc3cc(sc23)-c2ccc(Br)cc2)cc(OC)c1OC |
|---|
| Structure | 
|
|---|
Search and Browse
