Reaction Details |
| Report a problem with these data |
Target | Interleukin-1 receptor antagonist protein |
---|
Ligand | BDBM50519951 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1878764 (CHEMBL4380158) |
---|
IC50 | >200000±n/a nM |
---|
Citation | Maben, Z; Arya, R; Rane, D; An, WF; Metkar, S; Hickey, M; Bender, S; Ali, A; Nguyen, TT; Evnouchidou, I; Schilling, R; Stratikos, E; Golden, J; Stern, LJ Discovery of Selective Inhibitors of Endoplasmic Reticulum Aminopeptidase 1. J Med Chem63:103-121 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Interleukin-1 receptor antagonist protein |
---|
Name: | Interleukin-1 receptor antagonist protein |
Synonyms: | IL-1RN | IL1 inhibitor | IL1RA_MOUSE | IRAP | Il-1ra | Il1rn | Interleukin-1 receptor antagonist protein |
Type: | PROTEIN |
Mol. Mass.: | 20273.13 |
Organism: | Mus musculus |
Description: | ChEMBL_109596 |
Residue: | 178 |
Sequence: | MEICWGPYSHLISLLLILLFHSEAACRPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGY
LQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEE
DKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ
|
|
|
BDBM50519951 |
---|
n/a |
---|
Name | BDBM50519951 |
Synonyms: | CHEMBL4439709 |
Type | Small organic molecule |
Emp. Form. | C19H19F3N2O4S |
Mol. Mass. | 428.425 |
SMILES | OC(=O)c1cccc(c1)S(=O)(=O)Nc1cc(ccc1N1CCCCC1)C(F)(F)F |
Structure |
|