| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Corticotropin-releasing factor receptor 1 |
|---|
| Ligand | BDBM50074330 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_51111 (CHEMBL666549) |
|---|
| Ki | 5±n/a nM |
|---|
| Citation |  Arvanitis, AG; Gilligan, PJ; Chorvat, RJ; Cheeseman, RS; Christos, TE; Bakthavatchalam, R; Beck, JP; Cocuzza, AJ; Hobbs, FW; Wilde, RG; Arnold, C; Chidester, D; Curry, M; He, L; Hollis, A; Klaczkiewicz, J; Krenitsky, PJ; Rescinito, JP; Scholfield, E; Culp, S; De Souza, EB; Fitzgerald, L; Grigoriadis, D; Tam, SW; Shen, HL Non-peptide corticotropin-releasing hormone antagonists: syntheses and structure-activity relationships of 2-anilinopyrimidines and -triazines. J Med Chem42:805-18 (1999) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Corticotropin-releasing factor receptor 1 |
|---|
| Name: | Corticotropin-releasing factor receptor 1 |
|---|
| Synonyms: | CRF-R | CRF-R2 Alpha | CRF1 | CRFR | CRFR1 | CRFR1_HUMAN | CRH-R 1 | CRHR | CRHR1 | Corticotropin releasing factor receptor 1 | Corticotropin-releasing factor receptor 1 (CRF-1) | Corticotropin-releasing factor receptor 1 (CRF1) | Corticotropin-releasing hormone receptor 1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 50744.31 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34998 |
|---|
| Residue: | 444 |
|---|
| Sequence: | MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRPGCTHWGDQADGALEVGAPWSGAPFQVRRSIRCLR
NIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGC
YLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYI
YQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFF
VNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARV
ARAMSIPTSPTRVSFHSIKQSTAV
|
|
|
|---|
| BDBM50074330 |
|---|
| n/a |
|---|
| Name | BDBM50074330 |
|---|
| Synonyms: | 3-({4-[(4-Dimethylamino-2-trifluoromethyl-phenyl)-ethyl-amino]-6-methyl-[1,3,5]triazin-2-yl}-propyl-amino)-propionitrile | CHEMBL354178 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H28F3N7 |
|---|
| Mol. Mass. | 435.4891 |
|---|
| SMILES | CCCN(CCC#N)c1nc(C)nc(n1)N(CC)c1ccc(cc1C(F)(F)F)N(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
