Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Serine protease 1 |
---|
Ligand | BDBM50076819 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_212734 |
---|
Ki | 25180±n/a nM |
---|
Citation | Ambler, J; Bentley, D; Brown, L; Dunnet, K; Farr, D; Janus, D; Le Grand, D; Menear, K; Mercer, M; Talbot, M; Tweed, M; Wathey, B The discovery of orally available thrombin inhibitors: optimisation of the P1 pharmacophore. Bioorg Med Chem Lett9:1103-8 (1999) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine protease 1 |
---|
Name: | Serine protease 1 |
Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
Type: | Enzyme |
Mol. Mass.: | 26557.80 |
Organism: | Homo sapiens (Human) |
Description: | P07477 |
Residue: | 247 |
Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
BDBM50076819 |
---|
n/a |
---|
Name | BDBM50076819 |
Synonyms: | 4-((S)-1-Hydroxymethyl-2-phenyl-ethylamino)-pyridine-3-sulfonic acid {(S)-1-(4-amino-phenyl)-2-[4-(2-fluoro-ethyl)-piperidin-1-yl]-2-oxo-ethyl}-amide | CHEMBL12506 |
Type | Small organic molecule |
Emp. Form. | C29H36FN5O4S |
Mol. Mass. | 569.691 |
SMILES | Nc1ccc(cc1)[C@H](NS(=O)(=O)c1cnccc1N[C@H](CO)Cc1ccccc1)C(=O)N1CCC(CCF)CC1 |
Structure |
|