| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50082925 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_55105 (CHEMBL665365) |
|---|
| IC50 | 2500±n/a nM |
|---|
| Citation |  Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF Structure-based design of selective inhibitors of dihydrofolate reductase: synthesis and antiparasitic activity of 2, 4-diaminopteridine analogues with a bridged diarylamine side chain. J Med Chem42:4853-60 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | Dihydrofolate reductase (DHFR) | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 19884.75 |
|---|
| Organism: | Mycobacterium avium |
|---|
| Description: | Recombinant Mycobacterium avium DHFR expressed in E. coli. |
|---|
| Residue: | 181 |
|---|
| Sequence: | MTRAEVGLVWAQSTSGVIGRGGDIPWSVPEDLTRFKEVTMGHTVIMGRRTWESLPAKVRP
LPGRRNVVVSRRPDFVAEGARVAGSLEAALAYAGSDPAPWVIGGAQIYLLALPHATRCEV
TEIEIDLRRDDDDALAPALDDSWVGETGEWLASRSGLRYRFHSYRRDPRSSVRGCSPSRP
S
|
|
|
|---|
| BDBM50082925 |
|---|
| n/a |
|---|
| Name | BDBM50082925 |
|---|
| Synonyms: | 6-Phenoxazin-10-ylmethyl-pteridine-2,4-diamine | CHEMBL423381 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H15N7O |
|---|
| Mol. Mass. | 357.3687 |
|---|
| SMILES | Nc1nc(N)c2nc(CN3c4ccccc4Oc4ccccc34)cnc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
