Reaction Details |
| Report a problem with these data |
Target | Chymotrypsinogen A |
---|
Ligand | BDBM50085360 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_215994 |
---|
IC50 | 9300.0±n/a nM |
---|
Citation | Hayashi, Y; Iijima, K; Katada, J; Kiso, Y Structure-activity relationship studies of chloromethyl ketone derivatives for selective human chymase inhibitors. Bioorg Med Chem Lett10:199-201 (2000) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymotrypsinogen A |
---|
Name: | Chymotrypsinogen A |
Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
Type: | Serine protease |
Mol. Mass.: | 25670.88 |
Organism: | Bos taurus (bovine) |
Description: | n/a |
Residue: | 245 |
Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
BDBM50085360 |
---|
n/a |
---|
Name | BDBM50085360 |
Synonyms: | CHEMBL302387 | N-((S)-1-Benzyl-3-chloro-2-oxo-propyl)-benzamide |
Type | Small organic molecule |
Emp. Form. | C17H16ClNO2 |
Mol. Mass. | 301.767 |
SMILES | ClCC(=O)[C@H](Cc1ccccc1)NC(=O)c1ccccc1 |
Structure |
|