| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma intracellular receptor 2 |
|---|
| Ligand | BDBM50532515 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1923201 (CHEMBL4426157) |
|---|
| Ki | 86±n/a nM |
|---|
| Citation |  Sun, H; Shi, M; Zhang, W; Zheng, YM; Xu, YZ; Shi, JJ; Liu, T; Gunosewoyo, H; Pang, T; Gao, ZB; Yang, F; Tang, J; Yu, LF Development of Novel Alkoxyisoxazoles as Sigma-1 Receptor Antagonists with Antinociceptive Efficacy. J Med Chem59:6329-43 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma intracellular receptor 2 |
|---|
| Name: | Sigma intracellular receptor 2 |
|---|
| Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20953.88 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q5U3Y7 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
|---|
| BDBM50532515 |
|---|
| n/a |
|---|
| Name | BDBM50532515 |
|---|
| Synonyms: | CHEMBL4470605 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H18BrClN2O3 |
|---|
| Mol. Mass. | 389.672 |
|---|
| SMILES | Cl.Brc1cccc(OCc2cc(OC[C@@H]3CCCN3)no2)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
