Reaction Details |
| Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM50532515 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1923201 (CHEMBL4426157) |
---|
Ki | 86±n/a nM |
---|
Citation | Sun, H; Shi, M; Zhang, W; Zheng, YM; Xu, YZ; Shi, JJ; Liu, T; Gunosewoyo, H; Pang, T; Gao, ZB; Yang, F; Tang, J; Yu, LF Development of Novel Alkoxyisoxazoles as Sigma-1 Receptor Antagonists with Antinociceptive Efficacy. J Med Chem59:6329-43 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20953.88 |
Organism: | Rattus norvegicus (Rat) |
Description: | Q5U3Y7 |
Residue: | 176 |
Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
BDBM50532515 |
---|
n/a |
---|
Name | BDBM50532515 |
Synonyms: | CHEMBL4470605 |
Type | Small organic molecule |
Emp. Form. | C15H18BrClN2O3 |
Mol. Mass. | 389.672 |
SMILES | Cl.Brc1cccc(OCc2cc(OC[C@@H]3CCCN3)no2)c1 |r| |
Structure |
|