Reaction Details |
| Report a problem with these data |
Target | Catechol O-methyltransferase |
---|
Ligand | BDBM50108877 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1929004 (CHEMBL4432180) |
---|
IC50 | 31±n/a nM |
---|
Citation | Silva, T; Mohamed, T; Shakeri, A; Rao, PP; Martínez-González, L; Pérez, DI; Martínez, A; Valente, MJ; Garrido, J; Uriarte, E; Serrão, P; Soares-da-Silva, P; Remião, F; Borges, F Development of Blood-Brain Barrier Permeable Nitrocatechol-Based Catechol O-Methyltransferase Inhibitors with Reduced Potential for Hepatotoxicity. J Med Chem59:7584-97 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Catechol O-methyltransferase |
---|
Name: | Catechol O-methyltransferase |
Synonyms: | COMT_RAT | Catechol O-methyltransferase | Catechol-O-methyltransferase | Comt |
Type: | Enzyme |
Mol. Mass.: | 29594.09 |
Organism: | Rattus norvegicus (Rat) |
Description: | n/a |
Residue: | 264 |
Sequence: | MPLAAVSLGLLLLALLLLLRHLGWGLVTIFWFEYVLQPVHNLIMGDTKEQRILRYVQQNA
KPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMA
RLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDM
VFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSY
LEYMKVVDGLEKAIYQGPSSPDKS
|
|
|
BDBM50108877 |
---|
n/a |
---|
Name | BDBM50108877 |
Synonyms: | (3,4-Dihydroxy-5-nitro-phenyl)-p-tolyl-methanone | (3,4-dihydroxy-5-nitrophenyl)(p-tolyl)methanone | CHEMBL1324 | Ro-40-7592 | TOLCAPONE | Talcapone | Tasmar |
Type | Small organic molecule |
Emp. Form. | C14H11NO5 |
Mol. Mass. | 273.2408 |
SMILES | Cc1ccc(cc1)C(=O)c1cc(O)c(O)c(c1)[N+]([O-])=O |
Structure |
|