Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Heme oxygenase 1 |
---|
Ligand | BDBM50535262 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1930141 (CHEMBL4433392) |
---|
IC50 | 2700±n/a nM |
---|
Citation | Salerno, L; Floresta, G; Ciaffaglione, V; Gentile, D; Margani, F; Turnaturi, R; Rescifina, A; Pittalą, V Progress in the development of selective heme oxygenase-1 inhibitors and their potential therapeutic application. Eur J Med Chem167:439-453 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Heme oxygenase 1 |
---|
Name: | Heme oxygenase 1 |
Synonyms: | HMOX1_RAT | HSP32 | Heme Oxygenase 1 (HO-1) | Heme oxygenase 1 | Hmox1 |
Type: | Enzyme |
Mol. Mass.: | 33005.15 |
Organism: | Rattus norvegicus (rat) |
Description: | HO-1 obtained from rat spleen was used in enzyme assays. |
Residue: | 289 |
Sequence: | MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTA
LEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHE
VGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQ
LYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRP
ASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
|
|
|
BDBM50535262 |
---|
n/a |
---|
Name | BDBM50535262 |
Synonyms: | CHEMBL4474542 |
Type | Small organic molecule |
Emp. Form. | C18H15BrN4 |
Mol. Mass. | 367.242 |
SMILES | Brc1ccc(Cn2c(Cn3ccnc3)nc3ccccc23)cc1 |
Structure |
|