| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM210927 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1933058 (CHEMBL4478710) |
|---|
| Ki | 2.1±n/a nM |
|---|
| Citation |  Reeve, SM; Scocchera, E; Ferreira, JJ; G-Dayanandan, N; Keshipeddy, S; Wright, DL; Anderson, AC Charged Propargyl-Linked Antifolates Reveal Mechanisms of Antifolate Resistance and Inhibit Trimethoprim-Resistant MRSA Strains Possessing Clinically Relevant Mutations. J Med Chem59:6493-500 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_STAAU | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase (DfrB) | Tetrahydrofolate dehydrogenase | folA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18249.71 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | n/a |
|---|
| Residue: | 159 |
|---|
| Sequence: | MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRN
VVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRG
DTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
|
|
|
|---|
| BDBM210927 |
|---|
| n/a |
|---|
| Name | BDBM210927 |
|---|
| Synonyms: | UCP1039 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H23N5O2 |
|---|
| Mol. Mass. | 389.4503 |
|---|
| SMILES | CCc1nc(N)nc(N)c1C#CCc1cc(OC)c(OC)c(c1)-c1ccncc1 |
|---|
| Structure | 
|
|---|
Search and Browse
