Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Fatty acid-binding protein, adipocyte |
---|
Ligand | BDBM50337278 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1972438 (CHEMBL4605256) |
---|
Ki | 50690±n/a nM |
---|
Citation | Su, H; Zou, Y; Chen, G; Dou, H; Xie, H; Yuan, X; Zhang, X; Zhang, N; Li, M; Xu, Y Exploration of Fragment Binding Poses Leading to Efficient Discovery of Highly Potent and Orally Effective Inhibitors of FABP4 for Anti-inflammation. J Med Chem63:4090-4106 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein, adipocyte |
---|
Name: | Fatty acid-binding protein, adipocyte |
Synonyms: | A-FABP | AFABP | ALBP | Adipocyte lipid-binding protein | FABP4 | FABP4_HUMAN | Fatty acid binding protein adipocyte | Fatty acid-binding protein 4 | Fatty acid-binding protein 4 (FABP4) |
Type: | Enzyme |
Mol. Mass.: | 14719.23 |
Organism: | Homo sapiens (Human) |
Description: | P15090 |
Residue: | 132 |
Sequence: | MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
|
|
|
BDBM50337278 |
---|
n/a |
---|
Name | BDBM50337278 |
Synonyms: | 2-(phenylamino)benzoic acid | 2-Phenylamino-benzoic acid | CHEMBL23832 | N-phenylanthranilic acid | US9271961, 2 | phenylanthranilic acid |
Type | Small organic molecule |
Emp. Form. | C13H11NO2 |
Mol. Mass. | 213.2319 |
SMILES | OC(=O)c1ccccc1Nc1ccccc1 |
Structure |
|