| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-like protein 1 |
|---|
| Ligand | BDBM50541338 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1984151 (CHEMBL4617557) |
|---|
| Ki | >23000±n/a nM |
|---|
| Citation |  Gapil Tiamas, S; Daressy, F; Abou Samra, A; Bignon, J; Steinmetz, V; Litaudon, M; Fourneau, C; Hoong Leong, K; Ariffin, A; Awang, K; Desrat, S; Roussi, F Pro-apoptotic carboxamide analogues of natural fislatifolic acid targeting Mcl-1 and Bcl-2. Bioorg Med Chem Lett30:0 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bcl-2-like protein 1 |
|---|
| Name: | Bcl-2-like protein 1 |
|---|
| Synonyms: | Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | B2CL1_HUMAN | BCL2-like 1 isoform 1 | BCL2L | BCL2L1 | BCLX | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl-xL/Bcl-2-binding component 3 | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD) |
|---|
| Type: | Mitochondrion membrane; Single-pass membrane protein |
|---|
| Mol. Mass.: | 26039.60 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 233 |
|---|
| Sequence: | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
|
|
|
|---|
| BDBM50541338 |
|---|
| n/a |
|---|
| Name | BDBM50541338 |
|---|
| Synonyms: | CHEMBL4647892 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H31NO3 |
|---|
| Mol. Mass. | 369.4971 |
|---|
| SMILES | [#6]-[#8]-[#6](=O)-[#6]-[#6]-[#7]-[#6](=O)-[#6@@H]-1-[#6]-[#6]=[#6](-[#6]-[#6]\[#6]=[#6](\[#6])-[#6])-[#6]-[#6@H]-1-c1ccccc1 |r,t:11| |
|---|
| Structure | 
|
|---|
Search and Browse
