Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Induced myeloid leukemia cell differentiation protein Mcl-1 |
---|
Ligand | BDBM50541323 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1984152 (CHEMBL4617558) |
---|
Ki | 4000±n/a nM |
---|
Citation | Gapil Tiamas, S; Daressy, F; Abou Samra, A; Bignon, J; Steinmetz, V; Litaudon, M; Fourneau, C; Hoong Leong, K; Ariffin, A; Awang, K; Desrat, S; Roussi, F Pro-apoptotic carboxamide analogues of natural fislatifolic acid targeting Mcl-1 and Bcl-2. Bioorg Med Chem Lett30:0 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Induced myeloid leukemia cell differentiation protein Mcl-1 |
---|
Name: | Induced myeloid leukemia cell differentiation protein Mcl-1 |
Synonyms: | BCL2L3 | Bcl-2-like protein 3 | Bcl-2-like protein 3 (Mcl-1) | Bcl-2-related protein EAT/mcl1 | Bcl2-L-3 | Induced myeloid leukemia cell differentiation protein (Mcl-1) | MCL1 | MCL1_HUMAN | Mcl-1 | Myeloid Cell factor-1 (Mcl-1) | Myeloid cell leukemia sequence 1 (BCL2-related) | mcl1/EAT |
Type: | Membrane; Single-pass membrane protein |
Mol. Mass.: | 37332.87 |
Organism: | Homo sapiens (Human) |
Description: | Q07820 |
Residue: | 350 |
Sequence: | MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
|
|
|
BDBM50541323 |
---|
n/a |
---|
Name | BDBM50541323 |
Synonyms: | CHEMBL4632892 |
Type | Small organic molecule |
Emp. Form. | C19H24O2 |
Mol. Mass. | 284.3927 |
SMILES | [#6]\[#6](-[#6])=[#6]\[#6]-[#6]-[#6]-1=[#6]-[#6]-[#6@@H](-[#6@H](-[#6]-1)-c1ccccc1)-[#6](-[#8])=O |r,t:6| |
Structure |
|