| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2 |
|---|
| Ligand | BDBM50541328 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1984153 (CHEMBL4617559) |
|---|
| Ki | 2700±n/a nM |
|---|
| Citation |  Gapil Tiamas, S; Daressy, F; Abou Samra, A; Bignon, J; Steinmetz, V; Litaudon, M; Fourneau, C; Hoong Leong, K; Ariffin, A; Awang, K; Desrat, S; Roussi, F Pro-apoptotic carboxamide analogues of natural fislatifolic acid targeting Mcl-1 and Bcl-2. Bioorg Med Chem Lett30:0 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2 |
|---|
| Name: | Apoptosis regulator Bcl-2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
|---|
| Type: | Homodimer or heterodimer |
|---|
| Mol. Mass.: | 26269.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10415 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
|---|
| BDBM50541328 |
|---|
| n/a |
|---|
| Name | BDBM50541328 |
|---|
| Synonyms: | CHEMBL4646299 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H27NO2 |
|---|
| Mol. Mass. | 313.4339 |
|---|
| SMILES | [#6]-[#8]-[#7]-[#6](=O)-[#6@@H]-1-[#6]-[#6]=[#6](-[#6]-[#6]\[#6]=[#6](\[#6])-[#6])-[#6]-[#6@H]-1-c1ccccc1 |r,t:7| |
|---|
| Structure | 
|
|---|
Search and Browse
