| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tubulin polymerization-promoting protein |
|---|
| Ligand | BDBM50099944 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_925239 (CHEMBL3073731) |
|---|
| EC50 | >100000±n/a nM |
|---|
| Citation |  Young, DH; Tice, CM; Michelotti, EL; Roemmele, RC; Slawecki, RA; Rubio, FM; Rolling, JA Structure-activity relationships of phenylcyclohexene and biphenyl antitubulin compounds against plant and mammalian cells. Bioorg Med Chem Lett11:1393-6 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tubulin polymerization-promoting protein |
|---|
| Name: | Tubulin polymerization-promoting protein |
|---|
| Synonyms: | 25 kDa brain-specific protein | TPPP | TPPP_BOVIN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 23484.86 |
|---|
| Organism: | Bos taurus |
|---|
| Description: | ChEMBL_106635 |
|---|
| Residue: | 218 |
|---|
| Sequence: | MADSRPKPANKTPPKSPGEPAKDKAAKRLSLEAEGAGEGAAAAGAELSALEEAFRKFAVH
GDARASGREMHGKNWSKLCRDCQVIDGRSVTVTDVDIVFSKIKGKSCRTITFEQFKEALE
ELAKKRFKDKSAEEAVREVHKLIEGKAPIISGVTKAISSPTVSRLTDTSKFTGSHKERFD
PSGRGKGRAGRVDLVDESGYVPGYKHAGTYDQKVQGGK
|
|
|
|---|
| BDBM50099944 |
|---|
| n/a |
|---|
| Name | BDBM50099944 |
|---|
| Synonyms: | 1-Methoxy-3-((1S,6R)-6-nitro-cyclohex-3-enyl)-benzene | CHEMBL282958 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H15NO3 |
|---|
| Mol. Mass. | 233.2631 |
|---|
| SMILES | COc1cccc(c1)[C@@H]1CC=CC[C@H]1[N+]([O-])=O |c:11| |
|---|
| Structure | 
|
|---|
Search and Browse
