Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Thromboxane A2 receptor |
---|
Ligand | BDBM50106546 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_207468 (CHEMBL816749) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Soper, DL; Milbank, JB; Mieling, GE; Dirr, MJ; Kende, AS; Cooper, R; Jee, WS; Yao, W; Chen, JL; Bodman, M; Lundy, MW; De, B; Stella, ME; Ebetino, FH; Wang, Y; deLong, MA; Wos, JA Synthesis and biological evaluation of prostaglandin-F alkylphosphinic acid derivatives as bone anabolic agents for the treatment of osteoporosis. J Med Chem44:4157-69 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Thromboxane A2 receptor |
---|
Name: | Thromboxane A2 receptor |
Synonyms: | Prostanoid TP receptor | TA2R_HUMAN | TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta |
Type: | Enyzme |
Mol. Mass.: | 37445.28 |
Organism: | Homo sapiens (Human) |
Description: | P21731 |
Residue: | 343 |
Sequence: | MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
|
|
|
BDBM50106546 |
---|
n/a |
---|
Name | BDBM50106546 |
Synonyms: | CHEMBL134546 | {6-[3,5-Dihydroxy-2-(3-hydroxy-oct-1-enyl)-cyclopentyl]-hex-4-enyl}-phosphinic acid |
Type | Small organic molecule |
Emp. Form. | C19H35O5P |
Mol. Mass. | 374.452 |
SMILES | CCCCC[C@H](O)\C=C\[C@H]1[C@H](O)C[C@H](O)[C@@H]1CC=CCCCP(O)=O |w:18.19| |
Structure |
|