Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Prostaglandin D2 receptor |
---|
Ligand | BDBM50106548 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_158168 (CHEMBL766131) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Soper, DL; Milbank, JB; Mieling, GE; Dirr, MJ; Kende, AS; Cooper, R; Jee, WS; Yao, W; Chen, JL; Bodman, M; Lundy, MW; De, B; Stella, ME; Ebetino, FH; Wang, Y; deLong, MA; Wos, JA Synthesis and biological evaluation of prostaglandin-F alkylphosphinic acid derivatives as bone anabolic agents for the treatment of osteoporosis. J Med Chem44:4157-69 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin D2 receptor |
---|
Name: | Prostaglandin D2 receptor |
Synonyms: | PD2R_HUMAN | PTGDR | Prostaglandin D2 | Prostaglandin D2 receptor | Prostanoid DP receptor |
Type: | Enzyme |
Mol. Mass.: | 40288.87 |
Organism: | Homo sapiens (Human) |
Description: | Q13258 |
Residue: | 359 |
Sequence: | MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
|
|
|
BDBM50106548 |
---|
n/a |
---|
Name | BDBM50106548 |
Synonyms: | CHEMBL440164 | {6-[3,5-Dihydroxy-2-(3-hydroxy-4-phenoxy-but-1-enyl)-cyclopentyl]-hex-4-enyl}-methyl-phosphinic acid |
Type | Small organic molecule |
Emp. Form. | C22H33O6P |
Mol. Mass. | 424.4676 |
SMILES | CP(O)(=O)CCCC=CC[C@H]1[C@@H](O)C[C@@H](O)[C@@H]1\C=C\[C@@H](O)COc1ccccc1 |w:7.6| |
Structure |
|