Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Gonadotropin-releasing hormone receptor |
---|
Ligand | BDBM50548472 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2022371 (CHEMBL4676184) |
---|
IC50 | 34±n/a nM |
---|
Citation | Panknin, O; Wagenfeld, A; Bone, W; Bender, E; Nowak-Reppel, K; Fernández-Montalván, AE; Nubbemeyer, R; Bäurle, S; Ring, S; Schmees, N; Prien, O; Schäfer, M; Friedrich, C; Zollner, TM; Steinmeyer, A; Mueller, T; Langer, G Discovery and Characterization of BAY 1214784, an Orally Available Spiroindoline Derivative Acting as a Potent and Selective Antagonist of the Human Gonadotropin-Releasing Hormone Receptor as Proven in a First-In-Human Study in Postmenopausal Women. J Med Chem63:11854-11881 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gonadotropin-releasing hormone receptor |
---|
Name: | Gonadotropin-releasing hormone receptor |
Synonyms: | GNRHR_RAT | GnRH receptor | GnRH-R | Gnrhr |
Type: | PROTEIN |
Mol. Mass.: | 37767.60 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_1335047 |
Residue: | 327 |
Sequence: | MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKL
QRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRM
IYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRV
LHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVS
EPVNHFFFLFAFLNPCFDPLIYGYFSL
|
|
|
BDBM50548472 |
---|
n/a |
---|
Name | BDBM50548472 |
Synonyms: | CHEMBL4749790 |
Type | Small organic molecule |
Emp. Form. | C30H32ClN3O5S |
Mol. Mass. | 582.11 |
SMILES | COc1ccc(cc1)S(=O)(=O)N1C(C)C2(CCN(CC2)C(C)=O)c2cc(ccc12)C(=O)NCc1ccccc1Cl |
Structure |
|