Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM50549969 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2026016 (CHEMBL4679829) |
---|
Ki | 1000±n/a nM |
---|
Citation | Kargbo, RB Sigma-1 and Sigma-2 Receptor Modulators as Potential Therapeutics for Alzheimer's Disease. ACS Med Chem Lett12:178-179 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | MAC30 | Meningioma-associated protein 30 | S2R | SGMR2_HUMAN | Sigma-2 receptor | Sigma2 receptor | TMEM97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20857.20 |
Organism: | Homo sapiens (Human) |
Description: | Q5BJF2 |
Residue: | 176 |
Sequence: | MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ
EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF
EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
|
|
|
BDBM50549969 |
---|
n/a |
---|
Name | BDBM50549969 |
Synonyms: | CHEMBL4795855 |
Type | Small organic molecule |
Emp. Form. | C23H31FN4O |
Mol. Mass. | 398.5168 |
SMILES | CCCn1nc(C(=O)N2CCCCC2)c2CN(CCc3ccc(F)cc3)CCc12 |
Structure |
|