Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Ligand | BDBM50552296 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2034043 (CHEMBL4688201) |
---|
IC50 | 16120±n/a nM |
---|
Citation | Du, L; Wang, X; Cui, G; Xu, B Design, synthesis and biological evaluation of novel thiazole-based derivatives as human Pin1 inhibitors. Bioorg Med Chem29:0 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Type: | PROTEIN |
Mol. Mass.: | 18248.11 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1502595 |
Residue: | 163 |
Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
BDBM50552296 |
---|
n/a |
---|
Name | BDBM50552296 |
Synonyms: | CHEMBL4753746 |
Type | Small organic molecule |
Emp. Form. | C22H24N4O4S |
Mol. Mass. | 440.515 |
SMILES | COC1CCN(CC1)c1nc(NCC(O)=O)c(s1)C(=O)Nc1ccc2ccccc2c1 |
Structure |
|