Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Ligand | BDBM50113127 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_66267 |
---|
Ki | >33000±n/a nM |
---|
Citation | Wei, L; Wu, Y; Wilkinson, DE; Chen, Y; Soni, R; Scott, C; Ross, DT; Guo, H; Howorth, P; Valentine, H; Liang, S; Spicer, D; Fuller, M; Steiner, J; Hamilton, GS Solid-phase synthesis of FKBP12 inhibitors: N-sulfonyl and N-carbamoylprolyl/pipecolyl amides. Bioorg Med Chem Lett12:1429-33 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
Type: | Isomerase |
Mol. Mass.: | 11953.09 |
Organism: | Homo sapiens (Human) |
Description: | P62942 |
Residue: | 108 |
Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
BDBM50113127 |
---|
n/a |
---|
Name | BDBM50113127 |
Synonyms: | CHEMBL33728 | Pyrrolidine-1,2-dicarboxylic acid 1-cyclohexylamide 2-[(3-phenyl-propyl)-amide] |
Type | Small organic molecule |
Emp. Form. | C21H31N3O2 |
Mol. Mass. | 357.4897 |
SMILES | O=C(NCCCc1ccccc1)C1CCCN1C(=O)NC1CCCCC1 |
Structure |
|