| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Estrogen-related receptor gamma |
|---|
| Ligand | BDBM485066 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2054280 (CHEMBL4709281) |
|---|
| IC50 | 44±n/a nM |
|---|
| Citation |  Kim, J; Hwang, H; Yoon, H; Lee, JE; Oh, JM; An, H; Ji, HD; Lee, S; Cha, E; Ma, MJ; Kim, DS; Lee, SJ; Kadayat, TM; Song, J; Lee, SW; Jeon, JH; Park, KG; Lee, IK; Jeon, YH; Chin, J; Cho, SJ An orally available inverse agonist of estrogen-related receptor gamma showed expanded efficacy for the radioiodine therapy of poorly differentiated thyroid cancer. Eur J Med Chem205:0 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Estrogen-related receptor gamma |
|---|
| Name: | Estrogen-related receptor gamma |
|---|
| Synonyms: | ERR gamma-2 | ERR3 | ERR3_HUMAN | ERRG2 | ESRRG | Estrogen receptor-related protein 3 | Estrogen-Related Receptor, gamma | Estrogen-related receptor gamma | KIAA0832 | NR3B3 | Nuclear receptor subfamily 3 group B member 3 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 51305.00 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1501351 |
|---|
| Residue: | 458 |
|---|
| Sequence: | MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGG
SSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
NSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSC
QACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSH
LLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSL
LQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMK
LEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMT
LPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
|
|
|
|---|
| BDBM485066 |
|---|
| n/a |
|---|
| Name | BDBM485066 |
|---|
| Synonyms: | US10934303, Cmpd No. 22i | US10934303, Example 60 | US11285226, Compound 22i |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H35NO2 |
|---|
| Mol. Mass. | 453.6151 |
|---|
| SMILES | OCCC\C(=C(/c1ccc(O)cc1)c1ccc(cc1)C1CCN(CC1)C1CC1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
