Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50509028 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2055743 (CHEMBL4710744) |
---|
Ki | 92±n/a nM |
---|
Citation | Sokias, R; Werry, EL; Alison Cheng, HW; Lloyd, JH; Sohler, G; Danon, JJ; Montgomery, AP; Du, JJ; Gao, Q; Hibbs, DE; Ittner, LM; Reekie, TA; Kassiou, M Tricyclic heterocycles display diverse sensitivity to the A147T TSPO polymorphism. Eur J Med Chem207:0 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
Type: | Enzyme |
Mol. Mass.: | 18834.74 |
Organism: | Homo sapiens (Human) |
Description: | P30536 |
Residue: | 169 |
Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
BDBM50509028 |
---|
n/a |
---|
Name | BDBM50509028 |
Synonyms: | CHEMBL4161842 |
Type | Small organic molecule |
Emp. Form. | C23H22N2O |
Mol. Mass. | 342.4336 |
SMILES | CCN(Cc1ccccc1)C(=O)Cn1c2ccccc2c2ccccc12 |
Structure |
|