| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50556263 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2055743 (CHEMBL4710744) |
|---|
| Ki | 9.3±n/a nM |
|---|
| Citation |  Sokias, R; Werry, EL; Alison Cheng, HW; Lloyd, JH; Sohler, G; Danon, JJ; Montgomery, AP; Du, JJ; Gao, Q; Hibbs, DE; Ittner, LM; Reekie, TA; Kassiou, M Tricyclic heterocycles display diverse sensitivity to the A147T TSPO polymorphism. Eur J Med Chem207:0 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM50556263 |
|---|
| n/a |
|---|
| Name | BDBM50556263 |
|---|
| Synonyms: | CHEMBL4742003 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H26N4O2 |
|---|
| Mol. Mass. | 414.4995 |
|---|
| SMILES | COc1ccc(cc1)-c1nn2c(C)cc(C)nc2c1CC(=O)N(C)Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
