Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50001683 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_223419 (CHEMBL844030) |
---|
IC50 | 7300±n/a nM |
---|
Citation | Rew, Y; Malkmus, S; Svensson, C; Yaksh, TL; Chung, NN; Schiller, PW; Cassel, JA; DeHaven, RN; Taulane, JP; Goodman, M Synthesis and biological activities of cyclic lanthionine enkephalin analogues: delta-opioid receptor selective ligands. J Med Chem45:3746-54 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50001683 |
---|
n/a |
---|
Name | BDBM50001683 |
Synonyms: | 13-[2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-7-benzyl-3,3,14,14-tetramethyl-6,9,12-trioxo-1,2-dithia-5,8,11-triaza-cyclotetradecane-4-carboxylic acid | 7-Benzyl-10-{[3-(4-hydroxy-phenyl)-pyrrolidine-2-carbonyl]-amino}-3,3-dimethyl-6,9-dioxo-1,2-dithia-5,8-diaza-cycloundecane-4-carboxylic acid | CHEMBL294616 | DPDPE |
Type | Small organic molecule |
Emp. Form. | C30H39N5O7S2 |
Mol. Mass. | 645.79 |
SMILES | CC1(C)SSC(C)(C)[C@@H](NC(=O)[C@@H](N)Cc2ccc(O)cc2)C(=O)NCC(=O)N[C@H](Cc2ccccc2)C(=O)N[C@H]1C(O)=O |
Structure |
|