| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma intracellular receptor 2 |
|---|
| Ligand | BDBM94507 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2068265 (CHEMBL4723518) |
|---|
| Ki | 1953±n/a nM |
|---|
| Citation |  Ye, N; Qin, W; Tian, S; Xu, Q; Wold, EA; Zhou, J; Zhen, XC Small Molecules Selectively Targeting Sigma-1 Receptor for the Treatment of Neurological Diseases. J Med Chem63:15187-15217 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma intracellular receptor 2 |
|---|
| Name: | Sigma intracellular receptor 2 |
|---|
| Synonyms: | MAC30 | Meningioma-associated protein 30 | S2R | SGMR2_HUMAN | Sigma-2 receptor | Sigma2 receptor | TMEM97 | Transmembrane protein 97 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20857.20 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q5BJF2 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ
EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF
EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
|
|
|
|---|
| BDBM94507 |
|---|
| n/a |
|---|
| Name | BDBM94507 |
|---|
| Synonyms: | 2-[2-(diethylamino)ethoxy]ethyl 1-phenylcyclopentane-1-carboxylate;2-hydroxypropane-1,2,3-tricarboxylic acid | 2-[2-(diethylamino)ethoxy]ethyl 1-phenylcyclopentane-1-carboxylate;2-oxidanylpropane-1,2,3-tricarboxylic acid | 2-hydroxypropane-1,2,3-tricarboxylic acid;1-phenyl-1-cyclopentanecarboxylic acid 2-[2-(diethylamino)ethoxy]ethyl ester | CARBETAPENTANE | CHEMBL73234 | Carbetapentane citrate | MLS002222257 | SMR000326757 | cid_90010 | citric acid;1-phenylcyclopentanecarboxylic acid 2-[2-(diethylamino)ethoxy]ethyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H31NO3 |
|---|
| Mol. Mass. | 333.465 |
|---|
| SMILES | CCN(CC)CCOCCOC(=O)C1(CCCC1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
