| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50308028 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2068266 (CHEMBL4723519) |
|---|
| Ki | 82±n/a nM |
|---|
| Citation |  Ye, N; Qin, W; Tian, S; Xu, Q; Wold, EA; Zhou, J; Zhen, XC Small Molecules Selectively Targeting Sigma-1 Receptor for the Treatment of Neurological Diseases. J Med Chem63:15187-15217 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50308028 |
|---|
| n/a |
|---|
| Name | BDBM50308028 |
|---|
| Synonyms: | 4-[3-(Methylsulfonyl)phenyl]-1-propylpiperidine | CHEMBL596802 | US20230414596, Compound Pridopidine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H23NO2S |
|---|
| Mol. Mass. | 281.414 |
|---|
| SMILES | CCCN1CCC(CC1)c1cccc(c1)S(C)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
