Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50124720 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_157538 |
---|
Ki | 0.200000±n/a nM |
---|
Citation | Kaltenbach, RF; Patel, M; Waltermire, RE; Harris, GD; Stone, BR; Klabe, RM; Garber, S; Bacheler, LT; Cordova, BC; Logue, K; Wright, MR; Erickson-Viitanen, S; Trainor, GL Synthesis, antiviral activity and pharmacokinetics of P1/P1' substituted 3-aminoindazole cyclic urea HIV protease inhibitors. Bioorg Med Chem Lett13:605-8 (2003) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50124720 |
---|
n/a |
---|
Name | BDBM50124720 |
Synonyms: | (4R,5S,6S,7R)-1-(3-Amino-1H-indazol-5-ylmethyl)-3-benzyl-4,7-bis-(3,5-dimethyl-benzyl)-5,6-dihydroxy-[1,3]diazepan-2-one | CHEMBL155456 |
Type | Small organic molecule |
Emp. Form. | C38H43N5O3 |
Mol. Mass. | 617.7797 |
SMILES | Cc1cc(C)cc(C[C@@H]2[C@H](O)[C@@H](O)[C@@H](Cc3cc(C)cc(C)c3)N(Cc3ccc4[nH]nc(N)c4c3)C(=O)N2Cc2ccccc2)c1 |
Structure |
|