Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Free fatty acid receptor 1 |
---|
Ligand | BDBM50563841 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2085012 (CHEMBL4766275) |
---|
EC50 | 120±n/a nM |
---|
Citation | Hamdouchi, C; Kahl, SD; Patel Lewis, A; Cardona, GR; Zink, RW; Chen, K; Eessalu, TE; Ficorilli, JV; Marcelo, MC; Otto, KA; Wilbur, KL; Lineswala, JP; Piper, JL; Coffey, DS; Sweetana, SA; Haas, JV; Brooks, DA; Pratt, EJ; Belin, RM; Deeg, MA; Ma, X; Cannady, EA; Johnson, JT; Yumibe, NP; Chen, Q; Maiti, P; Montrose-Rafizadeh, C; Chen, Y; Reifel Miller, A The Discovery, Preclinical, and Early Clinical Development of Potent and Selective GPR40 Agonists for the Treatment of Type 2 Diabetes Mellitus (LY2881835, LY2922083, and LY2922470). J Med Chem59:10891-10916 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Free fatty acid receptor 1 |
---|
Name: | Free fatty acid receptor 1 |
Synonyms: | FFAR1_MOUSE | Ffar1 | Gpr40 |
Type: | PROTEIN |
Mol. Mass.: | 31818.80 |
Organism: | Mus musculus |
Description: | ChEMBL_1454431 |
Residue: | 300 |
Sequence: | MDLPPQLSFALYVSAFALGFPLNLLAIRGAVSHAKLRLTPSLVYTLHLGCSDLLLAITLP
LKAVEALASGAWPLPLPFCPVFALAHFAPLYAGGGFLAALSAGRYLGAAFPFGYQAIRRP
RYSWGVCVAIWALVLCHLGLALGLETSGSWLDNSTSSLGINIPVNGSPVCLEAWDPDSAR
PARLSFSILLFFLPLVITAFCYVGCLRALVRSGLSHKRKLRAAWVAGGALLTLLLCLGPY
NASNVASFINPDLGGSWRKLGLITGAWSVVLNPLVTGYLGTGPGRGTICVTRTQRGTIQK
|
|
|
BDBM50563841 |
---|
n/a |
---|
Name | BDBM50563841 |
Synonyms: | CHEMBL4786299 |
Type | Small organic molecule |
Emp. Form. | C33H32FNO3 |
Mol. Mass. | 509.6105 |
SMILES | CC#C[C@H](CC(O)=O)c1ccc(OCc2ccc(CN3CCC4(CC3)C=Cc3ccccc43)cc2)cc1F |r,c:26| |
Structure |
|