| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Free fatty acid receptor 1 |
|---|
| Ligand | BDBM50563841 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2085012 (CHEMBL4766275) |
|---|
| EC50 | 120±n/a nM |
|---|
| Citation |  Hamdouchi, C; Kahl, SD; Patel Lewis, A; Cardona, GR; Zink, RW; Chen, K; Eessalu, TE; Ficorilli, JV; Marcelo, MC; Otto, KA; Wilbur, KL; Lineswala, JP; Piper, JL; Coffey, DS; Sweetana, SA; Haas, JV; Brooks, DA; Pratt, EJ; Belin, RM; Deeg, MA; Ma, X; Cannady, EA; Johnson, JT; Yumibe, NP; Chen, Q; Maiti, P; Montrose-Rafizadeh, C; Chen, Y; Reifel Miller, A The Discovery, Preclinical, and Early Clinical Development of Potent and Selective GPR40 Agonists for the Treatment of Type 2 Diabetes Mellitus (LY2881835, LY2922083, and LY2922470). J Med Chem59:10891-10916 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Free fatty acid receptor 1 |
|---|
| Name: | Free fatty acid receptor 1 |
|---|
| Synonyms: | FFAR1_MOUSE | Ffar1 | Gpr40 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 31818.80 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_1454431 |
|---|
| Residue: | 300 |
|---|
| Sequence: | MDLPPQLSFALYVSAFALGFPLNLLAIRGAVSHAKLRLTPSLVYTLHLGCSDLLLAITLP
LKAVEALASGAWPLPLPFCPVFALAHFAPLYAGGGFLAALSAGRYLGAAFPFGYQAIRRP
RYSWGVCVAIWALVLCHLGLALGLETSGSWLDNSTSSLGINIPVNGSPVCLEAWDPDSAR
PARLSFSILLFFLPLVITAFCYVGCLRALVRSGLSHKRKLRAAWVAGGALLTLLLCLGPY
NASNVASFINPDLGGSWRKLGLITGAWSVVLNPLVTGYLGTGPGRGTICVTRTQRGTIQK
|
|
|
|---|
| BDBM50563841 |
|---|
| n/a |
|---|
| Name | BDBM50563841 |
|---|
| Synonyms: | CHEMBL4786299 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H32FNO3 |
|---|
| Mol. Mass. | 509.6105 |
|---|
| SMILES | CC#C[C@H](CC(O)=O)c1ccc(OCc2ccc(CN3CCC4(CC3)C=Cc3ccccc43)cc2)cc1F |r,c:26| |
|---|
| Structure | 
|
|---|
Search and Browse
