Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Ligand | BDBM50335225 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2092218 (CHEMBL4773481) |
---|
Ki | 230±n/a nM |
---|
Citation | Scheuplein, NJ; Bzdyl, NM; Kibble, EA; Lohr, T; Holzgrabe, U; Sarkar-Tyson, M Targeting Protein Folding: A Novel Approach for the Treatment of Pathogenic Bacteria. J Med Chem63:13355-13388 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
Type: | Isomerase |
Mol. Mass.: | 11953.09 |
Organism: | Homo sapiens (Human) |
Description: | P62942 |
Residue: | 108 |
Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
BDBM50335225 |
---|
n/a |
---|
Name | BDBM50335225 |
Synonyms: | (S)-1-Phenylmethanesulfonyl-piperidine-2-carboxylic acid 3-(3,4,5-trimethoxy-phenyl)-propyl ester | (S)-3-(3,4,5-Trimethoxyphenyl)propyl 1-(benzylsulfonyl)-piperidine-2-carboxylate | CHEMBL109278 |
Type | Small organic molecule |
Emp. Form. | C25H33NO7S |
Mol. Mass. | 491.597 |
SMILES | COc1cc(CCCOC(=O)[C@@H]2CCCCN2S(=O)(=O)Cc2ccccc2)cc(OC)c1OC |
Structure |
|