| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Ligand | BDBM50437711 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2092228 (CHEMBL4773491) |
|---|
| IC50 | 1500±n/a nM |
|---|
| Citation |  Scheuplein, NJ; Bzdyl, NM; Kibble, EA; Lohr, T; Holzgrabe, U; Sarkar-Tyson, M Targeting Protein Folding: A Novel Approach for the Treatment of Pathogenic Bacteria. J Med Chem63:13355-13388 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18248.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1502595 |
|---|
| Residue: | 163 |
|---|
| Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
|---|
| BDBM50437711 |
|---|
| n/a |
|---|
| Name | BDBM50437711 |
|---|
| Synonyms: | CHEMBL2409076 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H18N2O8 |
|---|
| Mol. Mass. | 438.3869 |
|---|
| SMILES | CCOC(=O)Cn1c(=O)c2ccc3c4c(ccc(c24)c1=O)c(=O)n(CC(=O)OCC)c3=O |
|---|
| Structure | 
|
|---|
Search and Browse
