| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP2 subtype |
|---|
| Ligand | BDBM50134515 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_158301 |
|---|
| Ki | 150±n/a nM |
|---|
| Citation |  Gallant, M; Belley, M; Carrière, MC; Chateauneuf, A; Denis, D; Lachance, N; Lamontagne, S; Metters, KM; Sawyer, N; Slipetz, D; Truchon, JF; Labelle, M Structure-activity relationship of triaryl propionic acid analogues on the human EP3 prostanoid receptor. Bioorg Med Chem Lett13:3813-6 (2003) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP2 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP2 subtype |
|---|
| Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39775.71 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P43116 |
|---|
| Residue: | 358 |
|---|
| Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
|---|
| BDBM50134515 |
|---|
| n/a |
|---|
| Name | BDBM50134515 |
|---|
| Synonyms: | 4-[3-(2-Benzyloxy-phenyl)-propyl]-benzoic acid | CHEMBL124199 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H22O3 |
|---|
| Mol. Mass. | 346.419 |
|---|
| SMILES | OC(=O)c1ccc(CCCc2ccccc2OCc2ccccc2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
