Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP2 subtype |
---|
Ligand | BDBM50134515 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_158301 |
---|
Ki | 150±n/a nM |
---|
Citation | Gallant, M; Belley, M; Carrière, MC; Chateauneuf, A; Denis, D; Lachance, N; Lamontagne, S; Metters, KM; Sawyer, N; Slipetz, D; Truchon, JF; Labelle, M Structure-activity relationship of triaryl propionic acid analogues on the human EP3 prostanoid receptor. Bioorg Med Chem Lett13:3813-6 (2003) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor EP2 subtype |
---|
Name: | Prostaglandin E2 receptor EP2 subtype |
Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
Type: | Enzyme |
Mol. Mass.: | 39775.71 |
Organism: | Homo sapiens (Human) |
Description: | P43116 |
Residue: | 358 |
Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
BDBM50134515 |
---|
n/a |
---|
Name | BDBM50134515 |
Synonyms: | 4-[3-(2-Benzyloxy-phenyl)-propyl]-benzoic acid | CHEMBL124199 |
Type | Small organic molecule |
Emp. Form. | C23H22O3 |
Mol. Mass. | 346.419 |
SMILES | OC(=O)c1ccc(CCCc2ccccc2OCc2ccccc2)cc1 |
Structure |
|