| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Corticotropin-releasing factor receptor 2 |
|---|
| Ligand | BDBM50135329 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_51269 (CHEMBL665760) |
|---|
| EC50 | 42±n/a nM |
|---|
| Citation |  Dubowchik, GM; Michne, JA; Zuev, D; Schwartz, W; Scola, PM; James, CA; Ruediger, EH; Pin, SS; Burris, KD; Balanda, LA; Gao, Q; Wu, D; Fung, L; Fiedler, T; Browman, KE; Taber, MT; Zhang, J 2-arylaminothiazoles as high-affinity corticotropin-releasing factor 1 receptor (CRF1R) antagonists: synthesis, binding studies and behavioral efficacy. Bioorg Med Chem Lett13:3997-4000 (2003) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Corticotropin-releasing factor receptor 2 |
|---|
| Name: | Corticotropin-releasing factor receptor 2 |
|---|
| Synonyms: | CRF-R 2 | CRF2 | CRF2R | CRFR2_HUMAN | CRH-R 2 | CRH2R | CRHR2 | Corticotropin releasing factor receptor 2 | Corticotropin-releasing factor receptor 2 (CRF-2) | Corticotropin-releasing factor receptor 2/Corticotropin-releasing factor-binding protein | Corticotropin-releasing hormone receptor 2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 47694.70 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q13324 |
|---|
| Residue: | 411 |
|---|
| Sequence: | MDAALLHSLLEANCSLALAEELLLDGWGPPLDPEGPYSYCNTTLDQIGTCWPRSAAGALV
ERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYRIALVVN
YLGHCVSVAALVAAFLLFLALRSIRCLRNVIHWNLITTFILRNVMWFLLQLVDHEVHESN
EVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTERLRKCLFLFIGWCIPFPIIV
AWAIGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTS
ETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIMFIYFNSFLQSFQGFFVSVFYC
FFNGEVRSAVRKRWHRWQDHHSLRVPMARAMSIPTSPTRISFHSIKQTAAV
|
|
|
|---|
| BDBM50135329 |
|---|
| n/a |
|---|
| Name | BDBM50135329 |
|---|
| Synonyms: | CHEMBL128100 | {5-[(Cyclopropylmethyl-propyl-amino)-methyl]-4-trifluoromethyl-thiazol-2-yl}-(2,4,6-trichloro-phenyl)-amine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H19Cl3F3N3S |
|---|
| Mol. Mass. | 472.783 |
|---|
| SMILES | CCCN(CC1CC1)Cc1sc(Nc2c(Cl)cc(Cl)cc2Cl)nc1C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
