Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase |
---|
Ligand | BDBM50136914 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_103130 (CHEMBL712301) |
---|
Ki | 3.9±n/a nM |
---|
Citation | Li, X; Chu, S; Feher, VA; Khalili, M; Nie, Z; Margosiak, S; Nikulin, V; Levin, J; Sprankle, KG; Tedder, ME; Almassy, R; Appelt, K; Yager, KM Structure-based design, synthesis, and antimicrobial activity of indazole-derived SAH/MTA nucleosidase inhibitors. J Med Chem46:5663-73 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase |
---|
Name: | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase |
Synonyms: | 5 -methylthioadenosine nucleosidase | 5'-methylthioadenosine nucleosidase | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (MTAN) | MTA/SAH nucleosidase | MTAN | MTNN_ECOLI | Methylthioadenosine Nucleosidase(MTAN) | P46 | S-adenosylhomocysteine nucleosidase | mtn | mtnN | pfs | yadA |
Type: | Enzyme |
Mol. Mass.: | 24347.14 |
Organism: | Escherichia coli (strain K12) |
Description: | P0AF12 |
Residue: | 232 |
Sequence: | MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGAT
LLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFK
ADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAH
VCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG
|
|
|
BDBM50136914 |
---|
n/a |
---|
Name | BDBM50136914 |
Synonyms: | 4'-Chloro-3'-methyl-biphenyl-3-sulfonic acid (3-chloro-7-isobutylamino-1H-indazol-5-yl)-amide | CHEMBL154218 |
Type | Small organic molecule |
Emp. Form. | C24H24Cl2N4O2S |
Mol. Mass. | 503.444 |
SMILES | CC(C)CNc1cc(NS(=O)(=O)c2cccc(c2)-c2ccc(Cl)c(C)c2)cc2c(Cl)[nH]nc12 |
Structure |
|