| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Alternative oxidase, mitochondrial |
|---|
| Ligand | BDBM50576972 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2128589 (CHEMBL4838018) |
|---|
| IC50 | 1.6±n/a nM |
|---|
| Citation |  Cueto-Díaz, EJ; Ebiloma, GU; Alfayez, IA; Ungogo, MA; Lemgruber, L; González-García, MC; Giron, MD; Salto, R; Fueyo-González, FJ; Shiba, T; González-Vera, JA; Ruedas Rama, MJ; Orte, A; de Koning, HP; Dardonville, C Synthesis, biological, and photophysical studies of molecular rotor-based fluorescent inhibitors of the trypanosome alternative oxidase. Eur J Med Chem220:0 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Alternative oxidase, mitochondrial |
|---|
| Name: | Alternative oxidase, mitochondrial |
|---|
| Synonyms: | 1.-.-.- | AOX | AOX_TRYBB | Alternative oxidase, mitochondrial |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 37603.97 |
|---|
| Organism: | Trypanosoma brucei brucei |
|---|
| Description: | ChEMBL_117839 |
|---|
| Residue: | 329 |
|---|
| Sequence: | MFRNHASRITAAAAPWVLRTACRQKSDAKTPVWGHTQLNRLSFLETVPVVPLRVSDESSE
DRPTWSLPDIENVAITHKKPNGLVDTLAYRSVRTCRWLFDTFSLYRFGSITESKVISRCL
FLETVAGVPGMVGGMLRHLSSLRYMTRDKGWINTLLVEAENERMHLMTFIELRQPGLPLR
VSIIITQAIMYLFLLVAYVISPRFVHRFVGYLEEEAVITYTGVMRAIDEGRLRPTKNDVP
EVARVYWNLSKNATFRDLINVIRADEAEHRVVNHTFADMHEKRLQNSVNPFVVLKKNPEE
MYSNQPSGKTRTDFGSEGAKTASNVNKHV
|
|
|
|---|
| BDBM50576972 |
|---|
| n/a |
|---|
| Name | BDBM50576972 |
|---|
| Synonyms: | CHEMBL4879019 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C44H59BrN2O6 |
|---|
| Mol. Mass. | 791.853 |
|---|
| SMILES | [Br-].CCOC(=O)c1cc(C)c(C(=O)OCCCCCCCCCCCCCC[n+]2ccc(\C=C\c3cc4CCCN5CCCc(c3O)c45)cc2)c(O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
