| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Type-1 angiotensin II receptor B |
|---|
| Ligand | BDBM50145976 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_34817 (CHEMBL648961) |
|---|
| IC50 | 13±n/a nM |
|---|
| Citation |  Cappelli, A; Pericot Mohr Gl, G; Gallelli, A; Rizzo, M; Anzini, M; Vomero, S; Mennuni, L; Ferrari, F; Makovec, F; Menziani, MC; De Benedetti, PG; Giorgi, G Design, synthesis, structural studies, biological evaluation, and computational simulations of novel potent AT(1) angiotensin II receptor antagonists based on the 4-phenylquinoline structure. J Med Chem47:2574-86 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Type-1 angiotensin II receptor B |
|---|
| Name: | Type-1 angiotensin II receptor B |
|---|
| Synonyms: | AGTRB_RAT | AT3 | Agtr1 | Agtr1b | Angiotensin II AT1B | Angiotensin II receptor (AT-1) type-1 | Angiotensin II type 1b (AT-1b) receptor | At1b | Type-1B angiotensin II receptor |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 40929.44 |
|---|
| Organism: | RAT |
|---|
| Description: | Angiotensin II AT1B 0 RAT::P29089 |
|---|
| Residue: | 359 |
|---|
| Sequence: | MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFR
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE
|
|
|
|---|
| BDBM50145976 |
|---|
| n/a |
|---|
| Name | BDBM50145976 |
|---|
| Synonyms: | 2-Amino-4-[4-(2-butyl-5,7-dimethyl-imidazo[4,5-b]pyridin-3-ylmethyl)-phenyl]-quinoline-3-carboxylic acid | CHEMBL315165 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H29N5O2 |
|---|
| Mol. Mass. | 479.5729 |
|---|
| SMILES | CCCCc1nc2c(C)cc(C)nc2n1Cc1ccc(cc1)-c1c(C(O)=O)c(N)nc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
