| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Acyl-protein thioesterase 1 |
|---|
| Ligand | BDBM50009366 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2133972 (CHEMBL4843582) |
|---|
| IC50 | 2.3±n/a nM |
|---|
| Citation |  ?imková, A; Ormsby, T; Sidej, N; Slav?tínská, LP; Brynda, J; Beranová, J; ?ácha, P; Majer, P; Konvalinka, J Structure-activity relationship and biochemical evaluation of novel fibroblast activation protein and prolyl endopeptidase inhibitors with ?-ketoamide warheads. Eur J Med Chem224:0 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Acyl-protein thioesterase 1 |
|---|
| Name: | Acyl-protein thioesterase 1 |
|---|
| Synonyms: | Acyl-protein thioesterase 1/2 | Apt1 | LYPA1_RAT | Lypla1 | Lysosomal phospholipase A1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 24708.49 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_12731 |
|---|
| Residue: | 230 |
|---|
| Sequence: | MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSSHIKYICPHAPVMP
VTLNMSMMMPSWFDIIGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLM
FGSLTVERLKGLVNPANVTFKVYEGMMHSSCQQEMMDVKYFIDKLLPPID
|
|
|
|---|
| BDBM50009366 |
|---|
| n/a |
|---|
| Name | BDBM50009366 |
|---|
| Synonyms: | CHEMBL3233842 | US11504364, Compound Ref.-Comp. | US9346814, Cmpd No 1, Example 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H14F2N4O2 |
|---|
| Mol. Mass. | 344.3155 |
|---|
| SMILES | FC1(F)C[C@@H](C#N)N(C1)C(=O)CNC(=O)c1ccnc2ccccc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
