| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocortin receptor 5 |
|---|
| Ligand | BDBM50152808 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_303255 (CHEMBL826381) |
|---|
| Ki | 240±n/a nM |
|---|
| Citation |  Pontillo, J; Tran, JA; Arellano, M; Fleck, BA; Huntley, R; Marinkovic, D; Lanier, M; Nelson, J; Parker, J; Saunders, J; Tucci, FC; Jiang, W; Chen, CW; White, NS; Foster, AC; Chen, C Structure-activity relationships of piperazinebenzylamines as potent and selective agonists of the human melanocortin-4 receptor. Bioorg Med Chem Lett14:4417-23 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocortin receptor 5 |
|---|
| Name: | Melanocortin receptor 5 |
|---|
| Synonyms: | MC-2 | MC5-R | MC5R | MC5R_HUMAN | Melanocortin MC5 | Melanocortin receptor (M4 and M5) | Melanocortin receptor 5 | Melanocortin receptor 5 (MC5R) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36612.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P33032 |
|---|
| Residue: | 325 |
|---|
| Sequence: | MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
|
|
|
|---|
| BDBM50152808 |
|---|
| n/a |
|---|
| Name | BDBM50152808 |
|---|
| Synonyms: | (R)-1,2,3,4-Tetrahydro-isoquinoline-3-carboxylic acid [(R)-1-(4-chloro-benzyl)-2-oxo-2-(4-{2-[(2-thiophen-2-yl-ethylamino)-methyl]-phenyl}-piperazin-1-yl)-ethyl]-amide | (R)-N-((R)-3-(4-chlorophenyl)-1-oxo-1-(4-(2-((2-(thiophen-2-yl)ethylamino)methyl)phenyl)piperazin-1-yl)propan-2-yl)-1,2,3,4-tetrahydroisoquinoline-3-carboxamide | 4-(2R)-[(3R)-1,2,3,4-tetrahydroisoquinolinylcarboxamido]-3-(4-chlorophenyl)propionyl-1-[2[2-(2-thienyl)-ethylaminomethyl]methyl]phenyl piperazine | CHEMBL366706 | NBI-55886 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C36H40ClN5O2S |
|---|
| Mol. Mass. | 642.253 |
|---|
| SMILES | Clc1ccc(C[C@@H](NC(=O)[C@H]2Cc3ccccc3CN2)C(=O)N2CCN(CC2)c2ccccc2CNCCc2cccs2)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
