Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM50584883 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2160848 (CHEMBL5045598) |
---|
Ki | 1200±n/a nM |
---|
Citation | Wen, Z; Salmaso, V; Jung, YH; Phung, NB; Gopinatth, V; Shah, Q; Patterson, AT; Randle, JCR; Chen, Z; Salvemini, D; Lieberman, DI; Whitehead, GS; Karcz, TP; Cook, DN; Jacobson, KA Bridged Piperidine Analogues of a High Affinity Naphthalene-Based P2Y J Med Chem65:3434-3459 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | MAC30 | Meningioma-associated protein 30 | S2R | SGMR2_HUMAN | Sigma-2 receptor | Sigma2 receptor | TMEM97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20857.20 |
Organism: | Homo sapiens (Human) |
Description: | Q5BJF2 |
Residue: | 176 |
Sequence: | MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ
EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF
EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
|
|
|
BDBM50584883 |
---|
n/a |
---|
Name | BDBM50584883 |
Synonyms: | CHEMBL5074765 |
Type | Small organic molecule |
Emp. Form. | C30H24F3NO2 |
Mol. Mass. | 487.5123 |
SMILES | [H][C@]12C[C@@H](c3ccc(cc3)-c3cc(cc4cc(ccc34)-c3ccc(cc3)C(F)(F)F)C(O)=O)[C@]([H])(CN1)C2 |r| |
Structure |
|