Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50159685 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_302899 (CHEMBL830360) |
---|
Ki | 28.2±n/a nM |
---|
Citation | Li, T; Fujita, Y; Tsuda, Y; Miyazaki, A; Ambo, A; Sasaki, Y; Jinsmaa, Y; Bryant, SD; Lazarus, LH; Okada, Y Development of potent mu-opioid receptor ligands using unique tyrosine analogues of endomorphin-2. J Med Chem48:586-92 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40465.04 |
Organism: | Rattus norvegicus (rat) |
Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
Residue: | 372 |
Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50159685 |
---|
n/a |
---|
Name | BDBM50159685 |
Synonyms: | 5N-[1-[1-carbamoyl-2-phenyl-(1S)-ethylcarbamoyl]-2-phenyl-(1S)-ethyl]-1-[2-amino-3-(4-hydroxy-2,5-dimethylphenyl)-(2S)-propanoyl]-(5S)-dihydro-1H-5-pyrrolecarboxamide | CHEMBL367635 |
Type | Small organic molecule |
Emp. Form. | C34H41N5O5 |
Mol. Mass. | 599.7198 |
SMILES | Cc1cc(C[C@H](N)C(=O)N2CCCC2C(=O)N[C@@H](Cc2ccccc2)C(=O)N[C@@H](Cc2ccccc2)C(N)=O)c(C)cc1O |
Structure |
|