| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50159685 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_305952 (CHEMBL831966) |
|---|
| IC50 | 0.261±n/a nM |
|---|
| Citation |  Li, T; Fujita, Y; Tsuda, Y; Miyazaki, A; Ambo, A; Sasaki, Y; Jinsmaa, Y; Bryant, SD; Lazarus, LH; Okada, Y Development of potent mu-opioid receptor ligands using unique tyrosine analogues of endomorphin-2. J Med Chem48:586-92 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50159685 |
|---|
| n/a |
|---|
| Name | BDBM50159685 |
|---|
| Synonyms: | 5N-[1-[1-carbamoyl-2-phenyl-(1S)-ethylcarbamoyl]-2-phenyl-(1S)-ethyl]-1-[2-amino-3-(4-hydroxy-2,5-dimethylphenyl)-(2S)-propanoyl]-(5S)-dihydro-1H-5-pyrrolecarboxamide | CHEMBL367635 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H41N5O5 |
|---|
| Mol. Mass. | 599.7198 |
|---|
| SMILES | Cc1cc(C[C@H](N)C(=O)N2CCCC2C(=O)N[C@@H](Cc2ccccc2)C(=O)N[C@@H](Cc2ccccc2)C(N)=O)c(C)cc1O |
|---|
| Structure | 
|
|---|
Search and Browse
