Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50588824 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2191892 (CHEMBL5104252) |
---|
IC50 | 1700±n/a nM |
---|
Citation | Barresi, E; Robello, M; Costa, B; Da Pozzo, E; Baglini, E; Salerno, S; Da Settimo, F; Martini, C; Taliani, S An update into the medicinal chemistry of translocator protein (TSPO) ligands. Eur J Med Chem209:0 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50588824 |
---|
n/a |
---|
Name | BDBM50588824 |
Synonyms: | CHEMBL5181685 |
Type | Small organic molecule |
Emp. Form. | C21H21N5O2 |
Mol. Mass. | 375.4237 |
SMILES | CCN(CC)C(=O)Cn1c2ccccc2c2nc(nn2c1=O)-c1ccccc1 |
Structure |
|