Reaction Details |
| Report a problem with these data |
Target | Cathepsin D |
---|
Ligand | BDBM50591319 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2199862 (CHEMBL5112378) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Lowe, MA; Cardenas, A; Valentin, JP; Zhu, Z; Abendroth, J; Castro, JL; Class, R; Delaunois, A; Fleurance, R; Gerets, H; Gryshkova, V; King, L; Lorimer, DD; MacCoss, M; Rowley, JH; Rosseels, ML; Royer, L; Taylor, RD; Wong, M; Zaccheo, O; Chavan, VP; Ghule, GA; Tapkir, BK; Burrows, JN; Duffey, M; Rottmann, M; Wittlin, S; Angulo-Barturen, I; Jiménez-Díaz, MB; Striepen, J; Fairhurst, KJ; Yeo, T; Fidock, DA; Cowman, AF; Favuzza, P; Crespo-Fernandez, B; Gamo, FJ; Goldberg, DE; Soldati-Favre, D; Laleu, B; de Haro, T Discovery and Characterization of Potent, Efficacious, Orally Available Antimalarial Plasmepsin X Inhibitors and Preclinical Safety Assessment of J Med Chem65:14121-14143 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cathepsin D |
---|
Name: | Cathepsin D |
Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
Type: | Enzyme |
Mol. Mass.: | 44551.72 |
Organism: | Homo sapiens (Human) |
Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
Residue: | 412 |
Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
BDBM50591319 |
---|
n/a |
---|
Name | BDBM50591319 |
Synonyms: | CHEMBL5204856 |
Type | Small organic molecule |
Emp. Form. | C23H25ClN4O3 |
Mol. Mass. | 440.923 |
SMILES | C[C@]1(CC(=O)N(C2CCOCC2)C(=N)N1)c1cccc(NC(=O)c2ccccc2)c1Cl |r| |
Structure |
|