| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin D |
|---|
| Ligand | BDBM50591320 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2199862 (CHEMBL5112378) |
|---|
| IC50 | 3889±n/a nM |
|---|
| Citation |  Lowe, MA; Cardenas, A; Valentin, JP; Zhu, Z; Abendroth, J; Castro, JL; Class, R; Delaunois, A; Fleurance, R; Gerets, H; Gryshkova, V; King, L; Lorimer, DD; MacCoss, M; Rowley, JH; Rosseels, ML; Royer, L; Taylor, RD; Wong, M; Zaccheo, O; Chavan, VP; Ghule, GA; Tapkir, BK; Burrows, JN; Duffey, M; Rottmann, M; Wittlin, S; Angulo-Barturen, I; Jiménez-Díaz, MB; Striepen, J; Fairhurst, KJ; Yeo, T; Fidock, DA; Cowman, AF; Favuzza, P; Crespo-Fernandez, B; Gamo, FJ; Goldberg, DE; Soldati-Favre, D; Laleu, B; de Haro, T Discovery and Characterization of Potent, Efficacious, Orally Available Antimalarial Plasmepsin X Inhibitors and Preclinical Safety Assessment of J Med Chem65:14121-14143 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cathepsin D |
|---|
| Name: | Cathepsin D |
|---|
| Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 44551.72 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
|---|
| Residue: | 412 |
|---|
| Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
|---|
| BDBM50591320 |
|---|
| n/a |
|---|
| Name | BDBM50591320 |
|---|
| Synonyms: | CHEMBL5190700 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H26ClN5O3 |
|---|
| Mol. Mass. | 479.959 |
|---|
| SMILES | C[C@H]1C[C@H](CCO1)N1C(=O)C[C@](C)(NC1=N)c1cccc(NC(=O)c2cccc(c2)C#N)c1Cl |r| |
|---|
| Structure | 
|
|---|
Search and Browse
