Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Appetite-regulating hormone |
---|
Ligand | BDBM50593265 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2207823 (CHEMBL5120531) |
---|
IC50 | 6.0±n/a nM |
---|
Citation | Li, HZ; Shao, XX; Shou, LL; Li, N; Liu, YL; Xu, ZG; Guo, ZY Development of Esterase-Resistant and Highly Active Ghrelin Analogs via Thiol-Ene Click Chemistry. ACS Med Chem Lett13:1655-1662 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Appetite-regulating hormone |
---|
Name: | Appetite-regulating hormone |
Synonyms: | GHRL | GHRL_HUMAN | Ghrelin | Ghrelin-27 | Ghrelin-28 | Growth hormone secretagogue | Growth hormone-releasing peptide | MTLRP | Motilin-related peptide | Obestatin | Protein M46 |
Type: | PROTEIN |
Mol. Mass.: | 12908.57 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_790253 |
Residue: | 117 |
Sequence: | MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPE
DGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
|
|
|
BDBM50593265 |
---|
n/a |
---|
Name | BDBM50593265 |
Synonyms: | CHEMBL5200946 |
Type | Small organic molecule |
Emp. Form. | C151H247N47O40S |
Mol. Mass. | 3392.933 |
SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CSCCCCc1ccccc1)NC(=O)[C@H](CO)NC(=O)CN)C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(O)=O |r| |
Structure |
|