Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Methionine aminopeptidase |
---|
Ligand | BDBM50169680 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_311781 (CHEMBL826403) |
---|
IC50 | 180±n/a nM |
---|
Citation | Cui, YM; Huang, QQ; Xu, J; Chen, LL; Li, JY; Ye, QZ; Li, J; Nan, FJ Identification of potent type I MetAP inhibitors by simple bioisosteric replacement. Part 1: Synthesis and preliminary SAR studies of thiazole-4-carboxylic acid thiazol-2-ylamide derivatives. Bioorg Med Chem Lett15:3732-6 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Methionine aminopeptidase |
---|
Name: | Methionine aminopeptidase |
Synonyms: | EcMetAP | MAP1_ECOLI | Methionine Aminopeptidase (MAP) | Methionine aminopeptidase | Peptidase M | map |
Type: | Enzyme |
Mol. Mass.: | 29326.96 |
Organism: | Escherichia coli (strain K12) |
Description: | Full-length untagged EcMAP was expressed in E. coli. |
Residue: | 264 |
Sequence: | MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACL
GYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTI
MGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEE
PQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVV
TDNGCEILTLRKDDTIPAIISHDE
|
|
|
BDBM50169680 |
---|
n/a |
---|
Name | BDBM50169680 |
Synonyms: | 5-Ethyl-thiazole-4-carboxylic acid thiazol-2-ylamide | CHEMBL180521 |
Type | Small organic molecule |
Emp. Form. | C9H9N3OS2 |
Mol. Mass. | 239.317 |
SMILES | CCc1scnc1C(=O)Nc1nccs1 |
Structure |
|