| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein arginine N-methyltransferase 6 |
|---|
| Ligand | BDBM50598022 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2225435 (CHEMBL5138948) |
|---|
| IC50 | 1750±n/a nM |
|---|
| Citation |  Iannelli, G; Milite, C; Marechal, N; Cura, V; Bonnefond, L; Troffer-Charlier, N; Feoli, A; Rescigno, D; Wang, Y; Cipriano, A; Viviano, M; Bedford, MT; Cavarelli, J; Castellano, S; Sbardella, G Turning Nonselective Inhibitors of Type I Protein Arginine Methyltransferases into Potent and Selective Inhibitors of Protein Arginine Methyltransferase 4 through a Deconstruction-Reconstruction and Fragment-Growing Approach. J Med Chem65:11574-11606 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein arginine N-methyltransferase 6 |
|---|
| Name: | Protein arginine N-methyltransferase 6 |
|---|
| Synonyms: | ANM6_HUMAN | HRMT1L6 | Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6 | Histone-arginine N-methyltransferase PRMT6 | PRMT6 | Protein arginine methyltransferase 6 (PRMT6) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 41928.48 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 375 |
|---|
| Sequence: | MSQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECYSDVSVHEEM
IADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQA
REVVRFNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKE
GGLLLPASAELFIAPISDQMLEWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQG
LSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGE
SEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYK
VGDQEEKTKDFAMED
|
|
|
|---|
| BDBM50598022 |
|---|
| n/a |
|---|
| Name | BDBM50598022 |
|---|
| Synonyms: | CHEMBL5173678 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H36N10O7 |
|---|
| Mol. Mass. | 648.6696 |
|---|
| SMILES | COC(=O)c1cc(O)c2cc(NC(=O)NCCCCNC(=N)NC\C=C\[C@H]3O[C@H]([C@H](O)[C@@H]3O)n3cnc4c(N)ncnc34)ccc2c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
