Reaction Details |
| Report a problem with these data |
Target | Protein arginine N-methyltransferase 8 |
---|
Ligand | BDBM50598022 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2225437 (CHEMBL5138950) |
---|
IC50 | 1950±n/a nM |
---|
Citation | Iannelli, G; Milite, C; Marechal, N; Cura, V; Bonnefond, L; Troffer-Charlier, N; Feoli, A; Rescigno, D; Wang, Y; Cipriano, A; Viviano, M; Bedford, MT; Cavarelli, J; Castellano, S; Sbardella, G Turning Nonselective Inhibitors of Type I Protein Arginine Methyltransferases into Potent and Selective Inhibitors of Protein Arginine Methyltransferase 4 through a Deconstruction-Reconstruction and Fragment-Growing Approach. J Med Chem65:11574-11606 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protein arginine N-methyltransferase 8 |
---|
Name: | Protein arginine N-methyltransferase 8 |
Synonyms: | ANM8_HUMAN | HRMT1L3 | HRMT1L3 | HRMT1L4 | Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4 | PRMT8 | Protein arginine N-methyltransferase 8 | Protein arginine N-methyltransferase 8 (PRMT8) | Protein arginine methyltransferase 8 (PRMT8) |
Type: | Protein |
Mol. Mass.: | 45293.70 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 394 |
Sequence: | MGMKHSSRCLLLRRKMAENAAESTEVNSPPSQPPQPVVPAKPVQCVHHVSTQPSCPGRGK
MSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGS
GTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVD
IIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWE
NVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQR
NDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISM
KPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
|
|
|
BDBM50598022 |
---|
n/a |
---|
Name | BDBM50598022 |
Synonyms: | CHEMBL5173678 |
Type | Small organic molecule |
Emp. Form. | C30H36N10O7 |
Mol. Mass. | 648.6696 |
SMILES | COC(=O)c1cc(O)c2cc(NC(=O)NCCCCNC(=N)NC\C=C\[C@H]3O[C@H]([C@H](O)[C@@H]3O)n3cnc4c(N)ncnc34)ccc2c1 |r| |
Structure |
|